General Information

  • ID:  hor003146
  • Uniprot ID:  D6WT67
  • Protein name:  RYamide-1
  • Gene name:  RYa
  • Organism:  Tribolium castaneum (Red flour beetle)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Tribolium (genus), Tenebrionidae incertae sedis, Tenebrionidae (family), Tenebrionoidea (superfamily), Cucujiformia (infraorder), Polyphaga (suborder), Coleoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VQNLATFKTMMRY
  • Length:  13
  • Propeptide:  MHARKLIVVLVYILTVLVSVAVSKRYTSEKRVQNLATFKTMMRYGRGGPSPNNKENKVNIRPRADAFFLGPRYGKRSGWSPNASLVYPVSTPLCGLDEDLSCAYTGISDLYRCTPRKGESEEFTTSSN
  • Signal peptide:  MHARKLIVVLVYILTVLVSVAVS
  • Modification:  T13 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptides RYamide-1 and RYamide-2 are ligands for the G-protein coupled receptor RYa-R. RYamide-2 is the most potent activator of RYa-R.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 7*10(-8)M
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-D6WT67-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003146_AF2.pdbhor003146_ESM.pdb

Physical Information

Mass: 181715 Formula: C71H115N19O19S2
Absent amino acids: CDEGHIPSW Common amino acids: MT
pI: 10.45 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -13.08 Boman Index: -1948
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60
Instability Index: -665.38 Extinction Coefficient cystines: 1490
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  21843505
  • Title:  Identification of the Drosophila and Tribolium Receptors for the Recently Discovered Insect RYamide Neuropeptides